Protein Info for GFF257 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfur oxidation molybdopterin C protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR04555: sulfite dehydrogenase" amino acids 32 to 444 (413 residues), 605.8 bits, see alignment E=1.9e-186 PF00174: Oxidored_molyb" amino acids 138 to 294 (157 residues), 163.2 bits, see alignment E=4.3e-52 PF03404: Mo-co_dimer" amino acids 322 to 431 (110 residues), 60.8 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: K00360, nitrate reductase (NADH) [EC: 1.7.1.1] K00387, sulfite oxidase [EC: 1.8.3.1] (inferred from 76% identity to har:HEAR1188)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.1 or 1.8.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>GFF257 Sulfur oxidation molybdopterin C protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSKDLSDVIGRVLPAPENHLSTEKLEQARKARRSFMGKALAMGAGAVTSAAASTRTLAAE
GEEAILKLPAHSTGLGQPVATLGYGLPSKWEGNLQRRQSPGLTRVPQASVSFTPLQGLFG
IITPSGLHFERHHQGWWDIDPSQHRLMVNGLVKRERVFTMDDLMRLPSVSRIHFIECGAN
SAPEWGNVALPSVQYTHGMVSCSEFTGVLLSTLLEMCGYDKKNGKYVLAEGADGSSMTRT
IDIDRAMDDCLVAWAMNGEMLRPENGYPLRLVVPGIQGVSWVKYLRRLEVGDQKWATKDE
AVHYIDHMPDGTHRQYTGIQECKSVITTPSGSQTLLDKGYYNVTGLAWSGRGAIKRVDVS
TDGGRNWRTARLEGPLLPKALTRFNIDWVWDGKPAVLQSRAIDSTGYVQPKINQLRAVRG
TRSIYHQNAIQSWRVAENGEVSNVQVF