Protein Info for GFF2567 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 297 to 324 (28 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 1 to 365 (365 residues), 317.2 bits, see alignment E=7.5e-99 PF07690: MFS_1" amino acids 14 to 323 (310 residues), 48.3 bits, see alignment E=3.5e-17

Best Hits

Swiss-Prot: 100% identical to NARU_SALTY: Nitrate/nitrite transporter NarU (narU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 99% identity to sek:SSPA1201)

MetaCyc: 85% identical to nitrate/nitrite transporter NarU (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-239

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>GFF2567 Nitrate/nitrite transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLFSAVAVNLNKIGFNFTTDQLFLLTALPSLSGAILRVPYSFMVPLFGGRKWTVLSTVIL
IIPCAWLGFAVQNPATPFGVFMLIALLCGFAGANFASSMGNISFFFPKARQGSALGINGG
LGNLGVSVMQLIAPLVIFLPIFTFLGVQGVPQPDGSLLALTNAAWIWVPLLAVATLAAWF
GMNDIGSSKASVASQLPVLKRLHLWLLSLLYLATFGSFIGFSAGFAMLAKTQFPDVNILQ
LAFFGPFIGALARSAGGVISDKFGGVRVTLINFIFMALFTALLFLTLPGSGAGSFSAFYL
VFMGLFLTAGLGSGSTFQMIAVIFRQITLYNVKLRGGSDEQAQREAVTDTAAALGFISAI
GAVGGFFIPKAFGTSLALTGSPVGAMKIFLLFYLACVLLTWLVYGRRKPKQQ