Protein Info for GFF2565 in Sphingobium sp. HT1-2

Annotation: Ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details PF01734: Patatin" amino acids 24 to 230 (207 residues), 94.4 bits, see alignment E=1.1e-30 PF12536: DUF3734" amino acids 268 to 368 (101 residues), 99.5 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: K07001, (no description) (inferred from 90% identity to sch:Sphch_1528)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF2565 Ferredoxin reductase (Sphingobium sp. HT1-2)
MADTESRPRRRATTPLPLPREVALLLQGGGALGSFQAGVYQRLDELGVDVSWVAGISIGA
VNAAIIAGNPPHRRLSQLKKFWLTVSGGMPNMILPEIDHIREAAHLMAAGTVATLGVPGM
FRPRLWPAPLMPEGSAGAISFYDSAPLKDTLDACVDWDLLNDGPVRLSVGAVDVETGNFA
YWDTRGPGGNTRIDARHIMASGALPPGLPPVEIDGRWYWDGGIVSNTPLAHVLNHQTDDM
LVFQVDLFPAEGPMPRQMTDVYSRMKDIQYSSRTRQVTDQYLRLRREHGAIKALLDKLPP
ELQDGPEAQKLRDMLDGGSVNIVHLIYRTRAWESGAKDFEFSRATMLDHWSQGREAVEEV
MHKGDLIARNILDGKSATFDLDAPDHLKEKMA