Protein Info for GFF256 in Xanthobacter sp. DMC5

Annotation: Biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 21 to 317 (297 residues), 364.6 bits, E=1.9e-113
• PF04055: Radical_SAM
  • amino acids 54 to 215 (162 residues), 75.8 bits, E=4.9e-25
• PF06968: BATS
  • amino acids 228 to 317 (90 residues), 86.1 bits, E=1.5e-28

Best Hits

Swiss-Prot: 78% identical to BIOB_AGRRK: Biotin synthase (bioB) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 78% identity to ara:Arad_3690)

MetaCyc: 53% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (11/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (3/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (2/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (2/5 steps found)
• biotin biosynthesis II (2/6 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (323 amino acids)

>GFF256 Biotin synthase (Xanthobacter sp. DMC5)
MAKTEDGTIRHDWSVDEIAALMDLPLLELVGRANAVHRANHDPNEVQRASLLSIKTGGCP
EDCAYCSQSARHAEVDLTREKFLDPASVVALAEQAQANGAERFCMGAAWRRVKEGREFDA
VLEMVRGVRGLGMEACVTLGMLEPHQAQRLAEAGLTAYNHNLDTGPDFYSEIVTTRTYAD
RIDTLTSVRAAGIELCSGGIIGMGETMRDRAAMLQVLAGFDPHPESVPVNALVAVEGTPL
ADRPPVDPLEIVRMVATARLVMPASRVRLSAGRAALSREAQILCFLAGANSVFYGDTLLT
TPNAGLGADAALFDAIGGAGVRG