Protein Info for GFF2554 in Variovorax sp. SCN45

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00892: EamA" amino acids 5 to 135 (131 residues), 39.6 bits, see alignment E=3.1e-14 amino acids 156 to 290 (135 residues), 40.5 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_4117)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF2554 Integral membrane protein (Variovorax sp. SCN45)
VPLSAFALILLAGIIHAGWNIVAKKANGDARFSFQTSVFNMLIWAPVGITLGWNVVPGWG
AAEWGFVVLSGVLHVFYFIVLLRGYRRSDLTVVYPLARGSGPLLSSLVAVLFLGEKISLF
GVAGIAGVVLGVFLVAGGPKLWRKSHDAAQRERVHKGIRYGVLTGGFIAAYTVVDSYAVK
FLVMSPILLDYFGNLVRIVLLLPVALKDRATTARMWRSQWKYAALVAAVSPVSYVLVLYA
VQQAPISHVAPAREVSMLFAALIGGHLLREGDRLLRLLGAVFIAAGVVALALG