Protein Info for GFF2550 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YcjO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 79 to 109 (31 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 181 to 196 (16 residues), see Phobius details amino acids 221 to 251 (31 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 299 (200 residues), 65.2 bits, see alignment E=3.3e-22

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 96% identity to xau:Xaut_0501)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF2550 Inner membrane ABC transporter permease protein YcjO (Xanthobacter sp. DMC5)
MANVAAAEPTHKRSFWAGIGQGRHVLGIAFMVPAAVFLLFFLTYPLGLGVWLGFTDTRIG
REGVFIGLENYQSLWGDSLFWLVVFNTLLYTIAASILKFALGLWLALLLNENLPFKAFFR
AVVLLPWVVPTVLSAIAFWWIFDSQYSIISWALIKMGLISAPINFLGDVTNARASVIAAN
VWRGIPFVAISLLAGLQTISPSLHEAATLDGATNWQRFRYITLPMLSPIIAVVMTFSVLF
TFTDFQLIYVLTRGGPLNSTHLMATLSFQRAIPGGSLGEGAAIAVAMIPFLLAAILFSYF
GLQRRKWQQGGAD