Protein Info for GFF255 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 375 to 399 (25 residues), see Phobius details PF05977: MFS_3" amino acids 18 to 398 (381 residues), 125.6 bits, see alignment E=2.2e-40 PF07690: MFS_1" amino acids 35 to 363 (329 residues), 97.7 bits, see alignment E=7e-32

Best Hits

KEGG orthology group: None (inferred from 54% identity to reh:H16_B2569)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF255 MFS permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTSALPSAPPEPSDVAALLRIVPFRLLLCARVAWTIGIQMVLVAIGWQMYDMTRDPWALA
LVGLYQFLPVLLLTLPAGLAADRWSRSRIMALCLLLQAVMAAGLSLGSWLGGLGREHLLL
ASLALGAARAFQMPALQATTPTTVPPRLLSRAMAASSTGSQASVIVGPAIGGMLMVLGIE
VVYATSTVLCVVAMLLVARLRMVPRKAVSRGASVDDLFAGVRFIAQRPIILGAILLDLFA
VLFGGAIALLPIYAREILEGGPGMLGWLRAAPAVGALAMSLYLMRNPPSTRVGFKLLLSV
AVFGLATITFGLSKLFWLSMLALMVNGAADMVSVVIRQTLVQLETPDEMRGRVSAVNSVF
IGASNQLGEFQSGAAATLVGPVAAVVLGGSATCLLALLWRRFFPQLARRQRLDSRG