Protein Info for GFF2546 in Variovorax sp. SCN45

Annotation: sodium-solute symporter, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 263 to 288 (26 residues), see Phobius details amino acids 314 to 341 (28 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 419 to 442 (24 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details PF00474: SSF" amino acids 30 to 427 (398 residues), 144.1 bits, see alignment E=3e-46

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_4795)

Predicted SEED Role

"sodium-solute symporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>GFF2546 sodium-solute symporter, putative (Variovorax sp. SCN45)
VLLTLVIVYLLVTIAIGLYAAKRVKNTTDFAIAGRHLPLFMIVTTTFATWFGSETVLGIP
AKFIEGGLNGVVEDPFGAGTCLILVGLFFAGKLYRMTLLTISDYYRERYGRTVEVACSLI
IMLSYLGWVSAQVTALGLVFNLLSAGVISIPMGMVIGVISILAYTLFGGMWSVAVTDFIQ
MIILVAGLAVIAMFAGSMAGGADKVVAFAVSKDLFKFWPEPSWHDMVFFFAAAITMMLGS
IPQQDVFQRVMSANSVKAATRGPVIGGLAYILFAFVPMFLVASALLIMPEQTATLLKEDP
QKVLPTLVLQKMPFVMQVLFFGALLSAIKSTASATLLAPSVTFTENIWRQFRPAGTDRQN
LMTMRITVLLFSAAVLAYAIRMQGTPIYELVSGAYQVPLVGAFVPLVCGLYWRRATTQGA
VASIVLGIGVWLLFLAVSAWGAVFPAQLAGVLCSFVGMVAGSLLPQWLANTHTPHRPLAA
EPA