Protein Info for GFF2545 in Sphingobium sp. HT1-2

Annotation: Lipopolysaccharide export system permease protein LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 12 to 363 (352 residues), 294 bits, see alignment E=5.7e-92 PF03739: LptF_LptG" amino acids 13 to 360 (348 residues), 242.1 bits, see alignment E=4.6e-76

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 87% identity to sch:Sphch_1515)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF2545 Lipopolysaccharide export system permease protein LptG (Sphingobium sp. HT1-2)
MQFDFFPSRQVSWYMVRLFLTRTLAVLAMLVVVLQMLDLLGNSGDILAYPGNGDAQLWHY
VGLRAPQIVARFLPFSVLLGTLIMLATLNQNSEIIAMKAAGLSAQQILAPLIAAALGVSA
LSYAFNERIVARSTAMLSAWQAVDFGPVPADSGIKTNPWVRDGNNLVTAAIVAGHGQDVQ
LRKVEIFNRINNSLTTIITAPKGHYDAASKSWVLEGARQFDVARGTLQNVGTVRFGSDIR
PDQFTLAKVDPDALTFSELQAAIGDLHDAGRPTAELEGSLWHKLSGPLSAVLMPILGSVA
AFGLARSGQLFLRAVMGMALGFAYFVADNFSLAMGNLGAYPPILAAWAPFLLFLLLGETV
LFRTEE