Protein Info for GFF2542 in Variovorax sp. SCN45

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 15 to 242 (228 residues), 285.5 bits, E=1.1e-88
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 20 to 242 (223 residues), 261.1 bits, E=3.4e-82
• PF07021: MetW
  • amino acids 51 to 153 (103 residues), 25.9 bits, E=2.9e-09
• PF13489: Methyltransf_23
  • amino acids 56 to 222 (167 residues), 39.3 bits, E=2.3e-13
• PF13847: Methyltransf_31
  • amino acids 59 to 221 (163 residues), 63.8 bits, E=6.4e-21
• PF13649: Methyltransf_25
  • amino acids 62 to 157 (96 residues), 74.9 bits, E=2.7e-24
• PF08241: Methyltransf_11
  • amino acids 63 to 161 (99 residues), 69.7 bits, E=1.1e-22
• PF08242: Methyltransf_12
  • amino acids 63 to 159 (97 residues), 41.6 bits, E=7e-14

Best Hits

Swiss-Prot: 70% identical to UBIE_PARP8: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 95% identity to vpe:Varpa_4799)

MetaCyc: 55% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Xanthomonas campestris pv. campestris)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• superpathway of menaquinol-10 biosynthesis (4/10 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• superpathway of menaquinol-9 biosynthesis (4/10 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.163

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Protein Sequence (243 amino acids)

>GFF2542 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201) (Variovorax sp. SCN45)
MSTTHFGFETVDESEKAQRVRGVFDSVASRYDIMNDLMSAGLHRAWKAYTVMVANVGEGS
RVLDIAGGTGDLALAFAKKVGATGQVVHTDINEAMLRTGRDRLLDAGVSLPTTVCDAEKL
PFPDNHFDVVTVAFGLRNMTHKDVALKEMNRVIKPRGKLLVLEFSKVAKPLAKAYDWYSF
NVLPRLGKLVAGDDASYRYLAESIRMHPSQEELKTLMKEGGFGHVDYHNMTGGIAALHVG
IKC