Protein Info for GFF2540 in Variovorax sp. SCN45

Annotation: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF01230: HIT" amino acids 19 to 103 (85 residues), 55.2 bits, see alignment E=4.8e-19

Best Hits

KEGG orthology group: None (inferred from 79% identity to vap:Vapar_4131)

Predicted SEED Role

"Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>GFF2540 Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases (Variovorax sp. SCN45)
MTAAVPQGCVLCEGLGGRLVFEGAKLRVIHAEEAGFPAFYRVIWREHAAEFSDLEAADRV
LCTEAVAVVEQCMRERLEPVKMNIAALGNMVPHLHWHVIARFTDDSHFPGSVWAPVQRER
NAAREAEIASQLPAVEAAMIERLGTRSF