Protein Info for GFF2537 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00072: Response_reg" amino acids 9 to 126 (118 residues), 76 bits, see alignment E=4e-25 PF08281: Sigma70_r4_2" amino acids 143 to 192 (50 residues), 32.6 bits, see alignment E=7.6e-12 PF00196: GerE" amino acids 151 to 204 (54 residues), 70.7 bits, see alignment E=9.5e-24

Best Hits

Swiss-Prot: 40% identical to TDIR_THAAR: Transcriptional regulatory protein TdiR (tdiR) from Thauera aromatica

KEGG orthology group: K11712, two-component system, LuxR family, response regulator DctR (inferred from 69% identity to ctt:CtCNB1_4745)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF2537 Two-component response regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTQHPEAKVYLVDDDAEVRQALAWLLRTRRLLSEGYDSAETFEADAAVWTGAPEAPCCVV
LDVRMPGLSGLALFERLLQLPWQAAVPVIFLSGHADVPTAVDAVKRGAFDFCEKPFSDNA
LVDRVEQALDRSAEVLAQQRVKRELQQRLNSLTDRERDVMDLVIAGLPNKLVADQLNISV
RTVEVHRSRVFDKMGVKSAVELANVLRPA