Protein Info for GFF2536 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details PF12792: CSS-motif" amino acids 37 to 228 (192 residues), 80.5 bits, see alignment E=1.2e-26 PF00563: EAL" amino acids 266 to 498 (233 residues), 214.7 bits, see alignment E=1.3e-67

Best Hits

KEGG orthology group: None (inferred from 54% identity to swi:Swit_2925)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>GFF2536 hypothetical protein (Sphingobium sp. HT1-2)
LRRRIIIFLALMLAILAIVIPLALTVHFSRERAIAAERAHMQEYANWTLLRAEQVLTDAK
DVLAQVGKGDCSDGHIERMRQLAIDSGAVEEVGHYDGDRLACTGWGKVPANVVIGRGTPS
ATLAGGYALHLHVKPRISHAREVMVLGYRDHNVLILPQRLVDVLSDSHMILGIATRQGTL
IAITGRANDGLVGQLSRQAMAGMDATDIYASVQRGDLTAFAIADRSAIDAKLGSEMRLLL
PIGLVASAILMLLILWVSRQRLSPEKELKLAIRKREFQVHYQPLIELSTGYCVGAEALVR
WRRPDGRWIAPDLFIPLAEQSGLILDITDHVIEQVVADLHVMLLAEQQVHVAINISARDL
ESGRFLDVLEREIAKAGIAPGQIWLEVTERSLINPDTARATIARARDAGHLMAIDDFGTG
YSSLSLLETLPLDALKIDKCFIDAIGRDAAASVVTPHIIGMGRALKLNLIAEGVETREQD
AYVRKAGVQFAQGWYYAKALPADEFMAFYRDYNRGKRSRFLSVAA