Protein Info for GFF2535 in Sphingobium sp. HT1-2

Annotation: SAM-dependent methyltransferase, BioC-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF13489: Methyltransf_23" amino acids 38 to 186 (149 residues), 40.6 bits, see alignment E=3.5e-14 PF13649: Methyltransf_25" amino acids 55 to 136 (82 residues), 29.4 bits, see alignment E=1.7e-10 PF08241: Methyltransf_11" amino acids 57 to 139 (83 residues), 50.2 bits, see alignment E=5.2e-17

Best Hits

KEGG orthology group: None (inferred from 80% identity to sjp:SJA_C1-26470)

Predicted SEED Role

"SAM-dependent methyltransferase, BioC-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF2535 SAM-dependent methyltransferase, BioC-like (Sphingobium sp. HT1-2)
MTAPETRPDIFDRTLRARHRDRMLGAFADHDFLHRAMLDELLERLADVQRDLPEVLLVGC
PDGSAKAALEVMGKRVACVDPGFLAAQRAGGVQADEDALPFADNSFDLVIACGTLDSVND
LPGALILMRRVLRPDGLMLAAFAGAGSLSRLKSALLAAEGDRPGQHVHPQVDVRSAGDLL
SRAGFAMPVADGETLNIRYGDIVRLMHDLRGMGAGNALATRPPALSRDVLMRAAAHFADA
ADPDGRTAEQMALIYLSGWKPDASQAAPARRGSATVSLAAALKGKD