Protein Info for GFF2534 in Variovorax sp. SCN45

Annotation: Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 113.8 bits, see alignment E=1e-36 PF08402: TOBE_2" amino acids 258 to 326 (69 residues), 41.2 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 60% identical to UGPC_BRUA2: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Brucella abortus (strain 2308)

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 96% identity to vpe:Varpa_4808)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>GFF2534 Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3) (Variovorax sp. SCN45)
MAALSLRNVIKRYGHGPKANQVIHGVSAEISDHEFIVIVGPSGCGKSTLLRMVAGLEEIS
AGEISIGNRVVNNLEPSERDIAMVFQNYALYPHMTVFDNMAYGLKILKVPVAEIKTRVDK
AAKILELGHLLARKPRELSGGQRQRVAMGRAIVRQPQVFLFDEPLSNLDAKLRAQTRLEI
QKLHRELGITSLFVTHDQVEAMTLAQRIIVMNGGVMDQFATPEEVYNRPATTFVASFIGS
PPMNLLKHAPGVRPGQILGIRPEHMKLDESGWTVQVEQVELLGAERLVYGRIGDEQIIMR
TDEGDHPPVTGDTVKIAAREDKLHWFDAGSGKRVD