Protein Info for GFF2532 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 12-TMS multidrug efflux protein homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF12832: MFS_1_like" amino acids 4 to 167 (164 residues), 46.1 bits, see alignment E=3.9e-16 PF07690: MFS_1" amino acids 25 to 278 (254 residues), 113 bits, see alignment E=1.5e-36 amino acids 260 to 400 (141 residues), 35.6 bits, see alignment E=5.1e-13

Best Hits

KEGG orthology group: None (inferred from 98% identity to stt:t1464)

Predicted SEED Role

"12-TMS multidrug efflux protein homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF2532 12-TMS multidrug efflux protein homolog (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNTNVYENTDSETITPLNKRRILPVFLLVGLYAASTAAVMSVLPFYIREMGGSPLIIGII
IATEAFSQFCAAPLIGHLSDRVGRKRILIVTLAIAAISLLLLANAQCILFILLARTLFGI
SAGNLSAAAAYIADCTHVRNRRQAIGILTGCIGLGGIVGAGVSGWLSRISLSAPIYAAFI
LVLGSALVAIWGLKDPSTTSRTTDKIAAFSARAILKMPVLRVLIIVMLCHFFAYGMYSSQ
LPVFLSDTFIWNGLPFGPKALSYLLMADGVINIFVQLFLLGWVSQYFSERKLIILIFALL
CTGFLTAGIATTIPVLVFAIVCISIADALAKPTYLAALSVHVSPARQGIVIGTAQALIAI
ADFISPVLGGFVLGYALYGVWIGIAISVAIIGLVTAMIYLSKSSVLIVKPETE