Protein Info for GFF253 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional activator MetR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF00126: HTH_1" amino acids 4 to 63 (60 residues), 62.8 bits, see alignment E=2.3e-21 PF03466: LysR_substrate" amino acids 86 to 288 (203 residues), 156.4 bits, see alignment E=7e-50

Best Hits

Swiss-Prot: 100% identical to METR_SALTI: HTH-type transcriptional regulator MetR (metR) from Salmonella typhi

KEGG orthology group: K03576, LysR family transcriptional regulator, regulator for metE and metH (inferred from 100% identity to sea:SeAg_B4193)

Predicted SEED Role

"Transcriptional activator MetR" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF253 Transcriptional activator MetR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIEIKHLKTLQALRNSGSLAAAAAVLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTP
QGEVLLQLANQVLPQISRALQACNEPQQTRLRIAIECHSCIQWLTPALENFRASWPQVEM
DFTSGVTFDPQPALQQGELDLVMTSDILPRSGLHYSPMFDFEVRLVLAPDHPLASKTQIT
PEDLASETLLIYPVQRSRLDVWRHFLQPAGISPLLKSVDNTLLLIQMVAARMGIAALPHW
VVESVERQGLVVTKTLGDGLWSRLYAAVRDGDQRQAVTEAFIRSTRDHACDHLPFVRSAE
RPIFDAPTAKPGSQPRL