Protein Info for GFF2529 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein PA3837

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 41 to 56 (16 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 254 (242 residues), 98 bits, see alignment E=2.7e-32

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 95% identity to vpe:Varpa_4813)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF2529 ABC transporter, permease protein PA3837 (Variovorax sp. SCN45)
MSLIASLGAIEIGLIFGLVALGVLMSFRIINFPDLTVDGSFPLGAAVAATLIVAGWNPVA
ATAVACVAGAVSGWVTAWLNVKLKIMQLLASILVMIALYSINLRVMGKPNVALITEPTVF
SMVDFGGMPEQWAKPLLLLLIVIIAKIVVDMFFASEAGLAMRATGGNARMARAQGISTDF
HTMAGLALSNALVALAGALFAQSQGTADISMGVGTIVIGLAAVIIGETLMPARSMVITTL
ACIIGALLYRFFIAMALNTDFMGLQAQDLNLVTAVLVAFALLVPAYKRKLGALFKGKN