Protein Info for GFF2525 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uptake hydrogenase small subunit precursor (EC 1.12.99.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00391: hydrogenase (NiFe) small subunit (hydA)" amino acids 1 to 319 (319 residues), 520.3 bits, see alignment E=1.5e-160 PF01058: Oxidored_q6" amino acids 25 to 170 (146 residues), 93.9 bits, see alignment E=6.9e-31 PF14720: NiFe_hyd_SSU_C" amino acids 190 to 270 (81 residues), 109.4 bits, see alignment E=9.6e-36

Best Hits

Swiss-Prot: 78% identical to MBHS_CUPNH: Uptake hydrogenase small subunit (hoxK) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K06282, hydrogenase small subunit [EC: 1.12.99.6] (inferred from 99% identity to sty:STY1523)

MetaCyc: 78% identical to hydrogenase small subunit (Cupriavidus necator)
Hydrogenase (acceptor). [EC: 1.12.99.6]

Predicted SEED Role

"Uptake hydrogenase small subunit precursor (EC 1.12.99.6)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase (EC 1.12.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF2525 Uptake hydrogenase small subunit precursor (EC 1.12.99.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIPQIAYALENKPRTPVIWLHGLECTCCTESFIRSAHPLAKDAILSLISLDYDDTIMAAA
GQQAEQALADVMREYKGNYIVAVEGNAPLNEDGMFCILAGEPFLEKLKRVSADAKAIIAW
GSCASWGCVQAARPNPTKATPVHKLITDKPIIKVPGCPPIPEVMSAVITYMLAFDRIPPL
DRLGRPKMFYGQRIHDKCYRRAHFDAGQFVEAWDDEGARKGYCLYKMGCKGPTTYNACST
VRWNDGVSFPIQSGHGCLGCSEDGFWDYGSFYSRATGIPQTGIEATADKIGLGVAGVAGA
AAIAHATVSAIKHARNKNNTSSENAPEEKK