Protein Info for GFF2523 in Xanthobacter sp. DMC5

Annotation: Glutamate synthase [NADPH] small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 TIGR01317: glutamate synthase, NADH/NADPH, small subunit" amino acids 3 to 472 (470 residues), 637.4 bits, see alignment E=8.2e-196 PF14691: Fer4_20" amino acids 23 to 133 (111 residues), 88.5 bits, see alignment E=1.7e-28 PF07992: Pyr_redox_2" amino acids 146 to 454 (309 residues), 97.3 bits, see alignment E=7.7e-31 PF01494: FAD_binding_3" amino acids 147 to 179 (33 residues), 26.1 bits, see alignment (E = 3.2e-09) PF01266: DAO" amino acids 147 to 181 (35 residues), 28.5 bits, see alignment 7.3e-10 PF00070: Pyr_redox" amino acids 147 to 218 (72 residues), 24.8 bits, see alignment E=1.7e-08 PF12831: FAD_oxidored" amino acids 148 to 188 (41 residues), 28.5 bits, see alignment 6.7e-10 PF00890: FAD_binding_2" amino acids 148 to 182 (35 residues), 27.2 bits, see alignment 1.5e-09 PF13450: NAD_binding_8" amino acids 150 to 185 (36 residues), 38.4 bits, see alignment 7.8e-13 PF01593: Amino_oxidase" amino acids 156 to 185 (30 residues), 30.1 bits, see alignment (E = 2.2e-10)

Best Hits

Swiss-Prot: 50% identical to GLTD_MYCTU: Glutamate synthase [NADPH] small chain (gltD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 94% identity to xau:Xaut_0476)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF2523 Glutamate synthase [NADPH] small chain (Xanthobacter sp. DMC5)
MGKVTGFLEIDRREQKYQPASDRIRHFREFTLPLPDAEVENQASRCMDCGIPFCHGSTGC
PVNNQIPDWNDLVYRNEWEEASRNLHSTNNFPEFTGRICPAPCEEACTLNLEDVPVTIKT
VEQAIADKAWKKGWIKPEPAAVKTGKKVAIIGSGPAGLAAAQQLARAGHDVHVYEREPKA
GGLLRYGIPDFKMEKHHIDRRVKQMEAEGVTFHYNENIGVVRPLQELLDGHDAVLLAGGS
EAPRDPGLPGQEMEGVHFAMPYLVQSNRREGDEPVNEIPILAGGKHVVVVGGGDTASDCV
GTAFRQGALSVTQLDIRAVPPMKEDKLAVWPFWPTKFRTSSSQAEGAEREFACATLGIEG
RNGRVTGVKCARVDAKRQPIPGTEFVLRADLVFLAIGFAHPLFSGLIEQSGAALDKRGNV
KADEEAYATSVPKLYAAGDMRRGQSLVVWAIREGRQAAHAIDKDLMGATTLPR