Protein Info for PS417_12865 in Pseudomonas simiae WCS417

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details amino acids 358 to 384 (27 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details PF00654: Voltage_CLC" amino acids 77 to 408 (332 residues), 253.2 bits, see alignment E=2.1e-79

Best Hits

KEGG orthology group: None (inferred from 68% identity to bgl:bglu_2g12690)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1F9 at UniProt or InterPro

Protein Sequence (415 amino acids)

>PS417_12865 chloride channel protein (Pseudomonas simiae WCS417)
MPTTFRSTLILALVVVLTGIGAGLGGMLLALLLHGIQHLAYGYSLDSLVSDETFLLGVTA
AAPERRLLVLVVCGLVAGLGWWAIYRYGRPLVSIKQAVAEKMPIMPPKTTLAHAVLQIIT
VALGSPLGREVAPREVGALAATWLSQRARLDPQMHRLLVACGAGAGLAAVYNVPLGGAVF
VLEVLVGAFSWPAAVIALATSAIAASVAWIGLGAQLQYEVPNFVLSPDLIAWAVVCGPVF
GVAAYAFTQLTGKARAQAARGWRLPVLALINFTIIGGLAMVLPQILGNGKGPAQLGFDNE
LSIGLAALLLVVKVLITISSLRAGAEGGLLTPGLANGALLAIILGGAWSLAWPGVPLGAF
AIIGAAAFLAASMSMPLTAIVLVAEFTRIDHDFLVPIILAVVGSMCMSKLCQRRW