Protein Info for PS417_12790 in Pseudomonas simiae WCS417

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details PF02308: MgtC" amino acids 32 to 157 (126 residues), 130.7 bits, see alignment E=1.9e-42

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 98% identity to pfs:PFLU2759)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3D2 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PS417_12790 methyltransferase (Pseudomonas simiae WCS417)
MDAWWLEVWQTLQAEFADIGDAKQLTQITVRLLIAATLGGILGFERESKGKAAGVRTHML
VALGAALFVMVPQMSGNQADAMSRVVQGVIAGIGFLGAGTIIKGKDDEEGHVKGLTTAAG
LWMTAAIGVSAGLGRESTAVLSTLLALVVFSVMPKIVKRFEKD