Protein Info for GFF2508 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Multiple antibiotic resistance protein MarC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 27 (5 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 2 to 213 (212 residues), 123 bits, see alignment E=6.7e-40 PF01914: MarC" amino acids 5 to 217 (213 residues), 216.7 bits, see alignment E=1.1e-68

Best Hits

Swiss-Prot: 100% identical to MARC_SALPB: UPF0056 inner membrane protein MarC (marC) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to sed:SeD_A1814)

Predicted SEED Role

"Multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>GFF2508 Multiple antibiotic resistance protein MarC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSYMASVYVFAIMMVAYY
AGQLVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHESPEAKSKSEELADEPTANIA
FVPLAMPSTAGPGTIAMIISSASTVRHGGEFPDWVIMVAPPIIFLAVAVILWGCLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIIKTYH