Protein Info for GFF2507 in Variovorax sp. SCN45

Annotation: Dephospho-CoA kinase (EC 2.7.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00152: dephospho-CoA kinase" amino acids 5 to 184 (180 residues), 143.6 bits, see alignment E=3.3e-46 PF01121: CoaE" amino acids 5 to 180 (176 residues), 183.5 bits, see alignment E=1.6e-58

Best Hits

Swiss-Prot: 59% identical to COAE_BURL3: Dephospho-CoA kinase (coaE) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 84% identity to vap:Vapar_4223)

MetaCyc: 46% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>GFF2507 Dephospho-CoA kinase (EC 2.7.1.24) (Variovorax sp. SCN45)
MVRRIGLTGGIGSGKSTVAALLVAQGAVLVDTDAIARSIAQPGGIAMPALEAAFGPGVIA
PDGGMDRAAMRQIVFADAGAKTRLESILHPLIGAETQRQAAAAGPDAIVVFDVPLLVESG
RWRAIVDRVLVVDAREETQLKRVIARSGWTPEATRAVIAQQAPRKARRAAADAVIYNDSL
TLEELGSEVRGLWERWVGTGTR