Protein Info for GFF2507 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Multiple antibiotic resistance protein MarR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 PF12802: MarR_2" amino acids 18 to 76 (59 residues), 29.7 bits, see alignment E=8.7e-11 PF01047: MarR" amino acids 19 to 77 (59 residues), 72.7 bits, see alignment E=2.7e-24

Best Hits

Swiss-Prot: 100% identical to MARR_SALTY: Multiple antibiotic resistance protein MarR (marR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03712, MarR family transcriptional regulator (inferred from 100% identity to stt:t1441)

Predicted SEED Role

"Multiple antibiotic resistance protein MarR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF2507 Multiple antibiotic resistance protein MarR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVNQKKDRLLNNYLSPLDITATQFKVLCSIRCAGCITPVELKKVLSVDLGALTRMLDRLL
CKGWIERLPNPNDKRGVLVKLTPDGAAICEQCHQRPGQDLHQELTKNLTADEVATLEYLL
KKILP