Protein Info for GFF2504 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08274: Zn_Ribbon_YjdM
  • amino acids 2 to 31 (30 residues), 62.9 bits, E=2.2e-21
• TIGR00686: putative alkylphosphonate utilization operon protein PhnA
  • amino acids 2 to 111 (110 residues), 173.2 bits, E=7.5e-56
• PF03831: YjdM
  • amino acids 44 to 111 (68 residues), 118.9 bits, E=6.7e-39

Best Hits

Swiss-Prot: 72% identical to YJDM_ECO57: Protein YjdM (yjdM) from Escherichia coli O157:H7

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 89% identity to meh:M301_0415)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• phosphonoacetate degradation (1/1 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Protein Sequence (111 amino acids)

>GFF2504 hypothetical protein (Methylophilus sp. DMC18)
MSLPACPKCQSEYTYEDGDNYVCPECAHEWSKVATAESEEVKVVRDANGNVLQDGDTITV
IKDLKVKGSSSVVKVGTKVKNIRLVDGDHDIDCKIDGFGAMKLKSEFVKKA