Protein Info for PS417_12755 in Pseudomonas simiae WCS417

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 49 to 504 (456 residues), 429.5 bits, see alignment E=7.9e-133 PF02321: OEP" amino acids 111 to 295 (185 residues), 78.4 bits, see alignment E=3.3e-26 amino acids 319 to 502 (184 residues), 117 bits, see alignment E=4.6e-38

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU2752)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ52 at UniProt or InterPro

Protein Sequence (515 amino acids)

>PS417_12755 RND transporter (Pseudomonas simiae WCS417)
MTDSTNANAPQSPVGAGLLAKNSPLPRTFRLCAFSLTTFASKLAPTMGLALLLSACAIGP
DYQRPEVVEPAQFKEAQGWRQATPSDSLARGAWWELYGDRQLNDLVMRLNTANQTVAQAE
ARFRQAQALARSSRGAFYPTVDLSVGKTRASQGTGSSNASLSSSSSGIRDTLNAQLGVSW
EADIWGKLRRGLEANEASAEASSADLAAMRLSQQSELVQSYLQLRVMDEQTRLLQATLET
YQRSLQMTENQYRAGVSGKDAVAQAQTQLKTTQASLIDLIWQRAQLENAIAVLIGEAPAN
FNLAVSKDIPALPQIPVSLPSQLLERRPDIASAERSVIAANANIGVAKAAYYPDLSLSLA
GGYSSSTYADWISLPNRFWSVGPKLAMTLFDGGQRSAEVDRTVASYDETVAKYRQTVLDG
FREVENYMVQLKVLEDEAVVSNEALEAARESLRLTQNQYKAGLIAYLDVVTVQATALSNE
RTVLTLLQTRLVASVQLIAALGGGWDGQTPIADKK