Protein Info for GFF2500 in Hydrogenophaga sp. GW460-11-11-14-LB1
Annotation: RecA protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 88% identical to RECA_DELAS: Protein RecA (recA) from Delftia acidovorans (strain DSM 14801 / SPH-1)
KEGG orthology group: K03553, recombination protein RecA (inferred from 85% identity to vpe:Varpa_5921)MetaCyc: 70% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (371 amino acids)
>GFF2500 RecA protein (Hydrogenophaga sp. GW460-11-11-14-LB1) MDAAVKNNPVNSEKAKALQAALAQIEKQFGKGTIMRLGEGEVIEDIQVVSTGSLGLDIAL GVGGLPKGRVVEIYGPESSGKTTLTLQVIAEMQKLGGQCAFVDAEHALDIQYAQKLGVNL QDLLISQPDTGEQALEIVDSLVRSGAVDLIVVDSVAALTPKAELEGEMGDSLPGLQARLM SQALRKLTAHIKKTNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGTI KKGEEAIGNETKVKVVKNKVSPPFKTAEFDILFGEGISREGEILDLGVVHRVIEKSGAWY AYNGEKIGQGRDNAREFLRENIELRVEIENKVRTELGVPLLPVDEAPAPAAKAGKAEKAA KAKDTDAASAA