Protein Info for GFF250 in Variovorax sp. SCN45

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 42 to 66 (25 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 122 to 138 (17 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 206 (191 residues), 112.1 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_2817)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF250 Homoserine/homoserine lactone efflux protein (Variovorax sp. SCN45)
MTLATALLFAIVAFAAIATPGPTVLLALSNGSRHGVRRALPGMLGAVLSDFVLVGAVALG
LGALLAASEFWFSMLKWVGAVYLAWLGLRMLRSKGGFQLPTADAAASVTAGESRRIFFKS
FLVAVTNPKGYIFCSALLPQFIDPTAAQAPQYIVIALIFAALDMAVMLAYAFVGARAIRL
LTVSATRWIDRACGGMLLALAGSLAFYRRSAA