Protein Info for GFF25 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: COG1720: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00104: tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA
  • amino acids 12 to 159 (148 residues), 198.9 bits, E=2.1e-63
• PF01980: TrmO
  • amino acids 33 to 152 (120 residues), 145.9 bits, E=6.1e-47
• PF18389: TrmO_C
  • amino acids 171 to 233 (63 residues), 84.6 bits, E=4.3e-28

Best Hits

Swiss-Prot: 89% identical to TRMO_ECOLI: tRNA (adenine(37)-N6)-methyltransferase (trmO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sew:SeSA_A0270)

MetaCyc: 89% identical to tRNA m6t6A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
2.1.1.-

Predicted SEED Role

"COG1720: Uncharacterized conserved protein"

Protein Sequence (246 amino acids)

>GFF25 COG1720: Uncharacterized conserved protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LYRVRPEYFGEMSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQADAVR
GLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSLVALKG
IECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPVSFTAEV
AQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRVVNSGFEV
FALEPR