Protein Info for PS417_12740 in Pseudomonas simiae WCS417

Annotation: secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 76 to 396 (321 residues), 248.2 bits, see alignment E=5.1e-78 PF13533: Biotin_lipoyl_2" amino acids 93 to 140 (48 residues), 49.6 bits, see alignment 4e-17 PF16576: HlyD_D23" amino acids 93 to 315 (223 residues), 42 bits, see alignment E=1e-14 PF13437: HlyD_3" amino acids 203 to 306 (104 residues), 28.9 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 46% identical to MDTA_CROTZ: Multidrug resistance protein MdtA (mdtA) from Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 98% identity to pfs:PFLU2749)

MetaCyc: 51% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3C4 at UniProt or InterPro

Protein Sequence (433 amino acids)

>PS417_12740 secretion protein HlyD (Pseudomonas simiae WCS417)
MVDHSMQSSPRKSRRWLFGLLVLLVIAGLCWKFWPGSHKDGAEKPAGHAGKTGMMRPGFG
GSTGPVPVRVAPAVLGEFPVYYKALGTVTALNTINVRSRVGGELVKIAFEEGQMVKAGDL
LAEIDPRSYQNALLQAQGTLMQNQAQLKNAQVDVQRYRDLYAQDSIAKQTLDTAEALVLQ
YQGTVKTNQGAVDDAKLNLEFTKIRAPISGRVGLRQVDVGNLVAANDTTFLAVITQTQPI
SVAFTLPENTLETVLTRYHAGNKLPVEAWDRGDVKQQAVGVLQSLDNQIDVTTGTLKFKA
RFDNKDQALFPNQFVNVHLLADTLHNVVLAPSAAIQFGNTGTFVYVLDGDKKVKVQPLVV
GDTDGDNTVIKEGLKAGDRVVLEGTDRLKDGSEIEVVNDSSEVPTTPTEHLQGKPAAKGE
TGTTAGKAQKVGS