Protein Info for GFF2497 in Sphingobium sp. HT1-2

Annotation: RNA binding methyltransferase FtsJ like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR00478: TlyA family rRNA methyltransferase/putative hemolysin" amino acids 5 to 236 (232 residues), 235.6 bits, see alignment E=2.2e-74 PF01479: S4" amino acids 5 to 49 (45 residues), 30.3 bits, see alignment 2.9e-11 PF01728: FtsJ" amino acids 60 to 242 (183 residues), 157.5 bits, see alignment E=3.5e-50

Best Hits

Swiss-Prot: 47% identical to YQXC_BACSU: Putative rRNA methyltransferase YqxC (yqxC) from Bacillus subtilis (strain 168)

KEGG orthology group: K06442, putative hemolysin (inferred from 85% identity to sch:Sphch_1380)

Predicted SEED Role

"RNA binding methyltransferase FtsJ like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF2497 RNA binding methyltransferase FtsJ like (Sphingobium sp. HT1-2)
MAKIRADQLLVDNGLAESRARAQALILAGLVYLGDKKVEKAGQQVAADAELDVRGRDHPW
VSRGGIKLAHAIDEYGIDVTGFVAIDVGSSTGGFTDVLLTKGAAKVYAVDSGTNQLAWKL
RSDDRVIVHEQTSARILTDAHITEPVDIIVCDASFISLAKVLEKPIGFARPGAQLVALIK
PQFEAGREEVGKGGVVRDPAIHQRVCDEVAAWVREKGWEVLGITTSPITGPQGNVEFLIH
ARLGG