Protein Info for GFF2495 in Pseudomonas sp. DMC3

Annotation: sugar efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 224 (207 residues), 95.3 bits, see alignment E=3.7e-31 amino acids 218 to 389 (172 residues), 62 bits, see alignment E=4.8e-21 PF00083: Sugar_tr" amino acids 44 to 184 (141 residues), 35.1 bits, see alignment E=7.5e-13

Best Hits

Swiss-Prot: 47% identical to YDER_BACSU: Uncharacterized MFS-type transporter YdeR (ydeR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_1589)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>GFF2495 sugar efflux transporter (Pseudomonas sp. DMC3)
MTTTPHAMTRGMVLLFAFCCGAIVANIYYAQPIIGLIAPDIGLSDTMASFIVSLTQIGYA
LGLFFLVPLGDLLENRRLMIITTVVAIASLLGAAFTEQPNVFLLISLLVGFSSVSVQILI
PLAAHLAPEESRGRVVGGIMGGLLLGILLARPVSSVVADHLGWRAMFMIAAALMAAISVV
LALTVPKRQPDHSATYGQLIGSLWTLLRQQPVLRQRAFYQGCMFATFSLFWTAVPLELAR
NHGLSQSEIAIFALVGAIGAIAAPISGRLADAGHTRIASLLAMLFASLSFLPAFIHPAYS
VIGLAVTGVVLDFCVQMNMVLGQRAVYSLDAKSRGRLNALYMTSIFIGGAFGSSVASAVY
EHGGWLWIVIVGSVFPLLALVRFLSVSRRASLATA