Protein Info for GFF249 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-lysine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 129 to 139 (11 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 14 to 205 (192 residues), 201.6 bits, see alignment E=4.4e-64 TIGR00949: homoserine/Threonine efflux protein" amino acids 18 to 202 (185 residues), 230.2 bits, see alignment E=7.5e-73

Best Hits

Swiss-Prot: 100% identical to RHTC_SALTY: Threonine efflux protein (rhtC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05835, threonine efflux protein (inferred from 99% identity to see:SNSL254_A4239)

MetaCyc: 91% identical to L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-0244

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF249 L-lysine permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMMLFFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGL
HLIIEKMAWLHTIIMVGGGLYLCWMGYQMLRGALKKQDAAASSPHIELAQSGRSFLKGLL
TNLSNPKAIIYFGSVFSLFVGDNVGAAARWGIFALITLETLAWFTVVASLFALPKMRRGY
QRLAKWIDGFAGALFAGFGIHLIISR