Protein Info for GFF2487 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative secreted protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF06932: DUF1283" amino acids 32 to 113 (82 residues), 152.9 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 100% identical to YNFB_SALNS: UPF0482 protein YnfB (ynfB) from Salmonella newport (strain SL254)

KEGG orthology group: None (inferred from 99% identity to ses:SARI_01439)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>GFF2487 putative secreted protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNNTLSKRLCLTAMLTLAAVVYTTSAFAETSKLVIESGDSAQSRQEAAMEKEQWNDTRSL
RQKVNTRAEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLDRRTGRVITP