Protein Info for GFF2485 in Sphingobium sp. HT1-2

Annotation: Outer membrane porin, OmpA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 8 to 82 (75 residues), 47.7 bits, see alignment E=2.6e-16 PF13488: Gly-zipper_Omp" amino acids 38 to 85 (48 residues), 34.7 bits, see alignment 2.6e-12 PF05433: Rick_17kDa_Anti" amino acids 38 to 81 (44 residues), 26.1 bits, see alignment 1.3e-09 PF00691: OmpA" amino acids 115 to 210 (96 residues), 88.9 bits, see alignment E=5e-29

Best Hits

Swiss-Prot: 46% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to sch:Sphch_2832)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>GFF2485 Outer membrane porin, OmpA family (Sphingobium sp. HT1-2)
MRISHRIMMAAGLAAMLTTTACTTDPETGQKRMSKAAIGGIGGALGGYLLGDLVGGRHDR
TEKILGAGIGAIAGAGIGSYMDEQERKLRQQTAGSGVDVIRQGDDLLLRMPSGITFAFND
ASVQPQFRPTLDEVSSILSQYPKTYIDVYGHTDSDGSDAYNQTLSERRAQSVAGYLTSHG
VQSARIATRGFGETQPIASNATEEGKAANRRVEIKISPVTESDVRS