Protein Info for GFF2479 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type hemin transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00005: ABC_tran" amino acids 61 to 215 (155 residues), 93 bits, see alignment E=2.5e-30

Best Hits

Swiss-Prot: 44% identical to HMUV_BURL3: Hemin import ATP-binding protein HmuV (hmuV) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 54% identity to vpe:Varpa_2075)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF2479 ABC-type hemin transport system, ATPase component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNARLLDADWRCACGELPAGERPLWLDDDDDDPVTDAPALDDGQGLCALDVGVRAGASTL
LQGVQLRLAPGEVGAILGPNGAGKSTLLSVLSGLRAPDTGRVTLNGLAVTPATVHQLARH
RAVLPQETAVAFDFRVQDVVELGRYPHHLQPSPHEAAIVRAAMQATGVADMADRSVSSLS
GGERARAQLARVMAQIWEPLADGAPRWLLLDEPTASLDLRHQHETLGTVQRWAREQGVGV
LAVLHDPNLALRYADRAWVLDGGVLQASGPPARVLRPALVQRVWQVQASTVRAADGVPQL
LIAAGVPPTTGKERP