Protein Info for GFF2477 in Xanthobacter sp. DMC5

Annotation: Histidine biosynthesis bifunctional protein HisB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12804: NTP_transf_3
  • amino acids 5 to 123 (119 residues), 28.6 bits, E=3.9e-10
• PF00483: NTP_transferase
  • amino acids 6 to 228 (223 residues), 58.8 bits, E=1.6e-19
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 237 to 382 (146 residues), 112.8 bits, E=1.4e-36
• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 238 to 383 (146 residues), 98.7 bits, E=3.1e-32
• PF13242: Hydrolase_like
  • amino acids 340 to 387 (48 residues), 35.3 bits, 2.2e-12
• PF13419: HAD_2
  • amino acids 341 to 380 (40 residues), 24 bits, 9.4e-09

Best Hits

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 54% identity to mrd:Mrad2831_1224)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Glycerophospholipid metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Retinol metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Protein Sequence (407 amino acids)

>GFF2477 Histidine biosynthesis bifunctional protein HisB (Xanthobacter sp. DMC5)
VTEQCVILLGGLGTRLGALTKDTPKPLLKVGDVPFVEVLIAEARRRGFRKFLLLAGYRAE
VVEHYITGTDVPGRFDCTVDISLEETPLGTGGALVNALPLLDESFLLVNGDTWFDFNWLD
LVATSRKNGAAFGMGLRLVQSPDRYETIALDGTRVAAVRPRGAGLTEALINGGVYYVRRD
VIEGLGMPSSLEGDLLPRLVAEGRVTGVAYDGFFIDIGIPETFTAAQTSVPARRRRPAVF
LDRDGVLNVDTGYVHAAENFTWIEGAREAIKLFNDLGYYVFLVTNQAGVARGYYEEEAIH
VLHAFVQAELREIGAELDDWRYCPFHPEGTVERYRGSHAWRKPEPGMILDLMANWPVDTA
HSFLIGDNPTDIAAAKAAGIAGHLFPGGDLLAFSCAILATSAAEPQS