Protein Info for PS417_12635 in Pseudomonas simiae WCS417

Annotation: alkanesulfonate monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR04021: dimethyl sulfone monooxygenase SfnG" amino acids 6 to 353 (348 residues), 618.1 bits, see alignment E=2.6e-190 PF00296: Bac_luciferase" amino acids 8 to 324 (317 residues), 222.8 bits, see alignment E=3.7e-70

Best Hits

Swiss-Prot: 92% identical to SFNG_PSEPF: FMNH(2)-dependent dimethylsulfone monooxygenase (sfnG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K04091, alkanesulfonate monooxygenase [EC: 1.14.14.5] (inferred from 99% identity to pfs:PFLU2730)

MetaCyc: 92% identical to dimethylsulfone monooxygenase (Pseudomonas fluorescens Pf0-1)
RXN-14709 [EC: 1.14.14.35]

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases; sulfonate monooxygenase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.5

Use Curated BLAST to search for 1.14.14.35 or 1.14.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBG2 at UniProt or InterPro

Protein Sequence (361 amino acids)

>PS417_12635 alkanesulfonate monooxygenase (Pseudomonas simiae WCS417)
MSQQAVKFAYWVPNVSGGLVVSKIEQRTHWGIDYNRKLAQLAEAAGFEYGLTQIRFTAGY
GAENQHESVAFSHALLAATTTLKVIAAILPGPWQPALAAKQLATIDQLTNGRIAVNIVSG
WFKGEFQAIGEHWLEHDERYRRSEEFIRALKGIWTQDDFTFKGDFYRFNEYTLKPKPLGQ
PEVFQGGSSRAARDMAARVSDWYFTNGNTPEGIKAQVDDIRAKAAANNHSVKVGVNAFVI
ARDTEEEARAVLAEIIDKADPEAVNAFGDAAKQAGKASPEGEGNWAKSSFEDLVQYNDGF
KTNLIGTPQQVAERIIALKAVGVDLVLAGFLHFQEEVEYFGKRVLPLVRELEAKAAIKSV
A