Protein Info for GFF2476 in Variovorax sp. SCN45

Annotation: Tripartite tricarboxylate transporter TctB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details PF07331: TctB" amino acids 11 to 153 (143 residues), 55.1 bits, see alignment E=5e-19

Best Hits

KEGG orthology group: None (inferred from 74% identity to adn:Alide_3645)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>GFF2476 Tripartite tricarboxylate transporter TctB family (Variovorax sp. SCN45)
VRIKSQRDFCSGVLFSAFGVAFAWGATTYNVGSGARMGPGYFPLIVGILIALMGVLITLK
ALSVETEDGEPIGSIAWKPLVFIIGANLIFGVLLGGLPSIGLPSMGLIVAIYALTFIASL
AGDNFGWKGVTVLASILALGSYLAFVVALKLQFQVWPTFISG