Protein Info for PS417_12590 in Pseudomonas simiae WCS417

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 36 to 372 (337 residues), 278.8 bits, see alignment E=2.5e-87 PF25917: BSH_RND" amino acids 60 to 203 (144 residues), 79 bits, see alignment E=3.9e-26 PF25876: HH_MFP_RND" amino acids 101 to 170 (70 residues), 71.4 bits, see alignment E=1.2e-23 PF25944: Beta-barrel_RND" amino acids 207 to 296 (90 residues), 59 bits, see alignment E=1e-19 PF25967: RND-MFP_C" amino acids 303 to 362 (60 residues), 51.8 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 47% identical to ACRA_ECO57: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli O157:H7

KEGG orthology group: K03585, membrane fusion protein (inferred from 96% identity to pfs:PFLU2721)

MetaCyc: 47% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U399 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PS417_12590 RND transporter (Pseudomonas simiae WCS417)
MSKNLFAPFCLLALTLALSACGDSAAEAPEMPLAKVRVETLEAKPLAITSELSGRIAAPR
IAEVRARVAGVVMQRVFKEGHDVKQGDVLFRIDPAPFKADLDSAQANLSKAEADAFKARL
QEQRYSQLVEGNAISGQDYDNARAAVRQTNAEVAANKAAVERARLNLGYATVTAPISGRI
GRALVTEGALVGQNEATPLALIQQLDPIHADLTQSTRELNDLRRAFRAGSLKQVGQDQAK
ATLIEDDGSLYPLPGKLLFAEISVDPGTGQIILRSEFPNPDLDLLPGSFVRVRLEQAVDK
QGISVPQRAITRDSAGIPMVLLLDAGQTVSQQPVELGAVINDRWIVSSGLKPGDRIIVEG
LQHARPGEKVEVDDSPLVKE