Protein Info for GFF2465 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR00274: N-acetylmuramic acid 6-phosphate etherase" amino acids 6 to 296 (291 residues), 413.2 bits, see alignment E=2.5e-128 PF13580: SIS_2" amino acids 35 to 165 (131 residues), 32 bits, see alignment E=2.9e-11 PF22645: GKRP_SIS_N" amino acids 48 to 154 (107 residues), 69.1 bits, see alignment E=6.7e-23 PF01380: SIS" amino acids 117 to 208 (92 residues), 42.1 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 100% identical to MURQ_SALNS: N-acetylmuramic acid 6-phosphate etherase (murQ) from Salmonella newport (strain SL254)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 99% identity to sea:SeAg_B2733)

MetaCyc: 55% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.-.-

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF2465 N-acetylmuramic acid 6-phosphate etherase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNLGTLVSETRNPQTMDLDALPTPELVKRFNEQDTLVAEAVKATLPDVARAVDAAAAALK
SGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVVGLIAGGPGALLKAVEGAEDSQQAG
EDDLVALNLQEQDLVVGLAASGRTPYVIGGLRYARQSGCTTVAVSCNPDSPIAREANIAI
SPVVGPEALTGSTRLKSGTAQKMVLNMISTGAMVKFGKVYQNLMVDMKATNVKLVDRACR
MVVEATGIGREEAEALLKQTDFEVKPAILMALTGLDAAAAREKLAAHQGFLRAALEH