Protein Info for GFF2464 in Methylophilus sp. DMC18

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 9 to 447 (439 residues), 416.9 bits, E=5.9e-129
• PF21799: MurD-like_N
  • amino acids 9 to 98 (90 residues), 84.5 bits, E=7.7e-28
• PF08245: Mur_ligase_M
  • amino acids 116 to 286 (171 residues), 105.9 bits, E=4.3e-34
• PF02875: Mur_ligase_C
  • amino acids 308 to 426 (119 residues), 52.4 bits, E=1.5e-17

Best Hits

Swiss-Prot: 58% identical to MURD_METFK: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 60% identity to meh:M301_2424)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Protein Sequence (456 amino acids)

>GFF2464 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Methylophilus sp. DMC18)
MKKHFEHQRIAVLGLGDTGFSALRWLRGMGAEVVMFDSRPHPSGLDRLQEEFPEVEYHLG
PFNSSLLAAMDLIVASPGVALKEPVLADLMAQGKAVVGDVELFARFRAPYAKVIAITGSN
GKTTVTSLVGEICKQAGLNTIVAGNIGLPVLDTLHMPAPDVYVLELSSFQLETTHSLEID
VATVLNLSEDHMDRYDSMTDYAQAKARIYQHARIAVVNRDDPASMALAGAMPQISFGVNP
APSINDYGLNDAGWLCAGNRHYIEADTLQIRGKHNIANALAAIALAQAIGIDKVSILHTV
QSFAGLPHRVEWVANIEDVDFYDDSKGTNVGATCAAISGMLKQGKPQKVVLIAGGDGKGQ
DFNPLRDAVLHHARAVVLIGRDGPKIQQVLQHLQLPVVDAVDLTAAVHIAKTLAEAGDAV
LLSPACASFDMFRNYEHRAQVFVEAVKAMEAACLGR