Protein Info for GFF2462 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00046: RNA methyltransferase, RsmE family
  • amino acids 12 to 238 (227 residues), 154.2 bits, E=1.8e-49
• PF20260: PUA_4
  • amino acids 19 to 63 (45 residues), 44.7 bits, 1.2e-15
• PF04452: Methyltrans_RNA
  • amino acids 73 to 238 (166 residues), 155.2 bits, E=1.2e-49

Best Hits

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 64% identity to vap:Vapar_5277)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (241 amino acids)

>GFF2462 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPRFHCPAPLLEGQPLSLPAAAARHVQVLRLQPGQTITLFNGQGGEWDATITRMGRSDVE
VVLGAHRATEREPARAVHLALGMPANDRMDWLVEKAAELGVASLQPLHTSHSVLRLAGER
ATKKQAHWQSVAVAACEQCGGNRVPTVHPVSDFAAWLKTLPPADAGLRCLLSLADGTQPL
ARALAGVPAPAPVWFLSGPEGGLNASEDALARAAGFLPVTLGPRVLRAETAALAALTLAL
G