Protein Info for GFF246 in Sphingobium sp. HT1-2

Annotation: Quinolinate synthetase (EC 2.5.1.72)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 12 to 316 (305 residues), 373.4 bits, see alignment E=4.4e-116 PF02445: NadA" amino acids 16 to 314 (299 residues), 395.9 bits, see alignment E=5.4e-123

Best Hits

Swiss-Prot: 59% identical to NADA_ANAVT: Quinolinate synthase A (nadA) from Anabaena variabilis (strain ATCC 29413 / PCC 7937)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 94% identity to sjp:SJA_C1-28390)

MetaCyc: 47% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF246 Quinolinate synthetase (EC 2.5.1.72) (Sphingobium sp. HT1-2)
MNAFTDIPQGTDLRAEIDRLRKERNAVILGHYYQSPEIQDLSDFVGDSLELSRKAAETDA
DVIAFCGVRFMAETAKILSPQKIVVLPDMDAGCSLEDSCPPAQFKAFREAHPDHIALSYI
NCSAEVKALSDIIVTSSSAEKILAQIPKDQKIIFGPDKHLGGYLKRKLGRDILLWPGVCI
VHEAFSETELLKLKAQHPNAPVAAHPECPPYIVDHADYVGSTSGILDFAKTMPGDTLIVA
TEPHIIHQMQKAVPDKNFIGAPGADGNCNCNICPYMALNTMEKLYLSLRDLSPRIEMDET
LRVAAKKSLDRMLEMASGTVGQGDLGAR