Protein Info for GFF2453 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details PF00672: HAMP" amino acids 213 to 260 (48 residues), 32.9 bits, see alignment 6.6e-12 PF00015: MCPsignal" amino acids 324 to 480 (157 residues), 176.9 bits, see alignment E=3.5e-56

Best Hits

KEGG orthology group: None (inferred from 55% identity to aaa:Acav_0045)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>GFF2453 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRQFSIRIRMRAAIGVVLMLLLLVGTAGWWGMARMHALNEDFVQSTFEETLTLSRLQVAL
GDMGRHEKDMIIAYEKPEAVLKAKALWQAARDEAQKQMDVLLAGNEDGENELVREMQSHL
TKYVAAVGPVTNQLESSGYDSATVANRMLGRAHGSYGDLLQSLKKLEEVLMADAASARQA
GKSANDQTLMLFGLAVAIAAVVVVPTTLSNMNSICRPLDQAQQVASAIAKGDLTRTIQRE
GKDETAALMRALGDMQASLVRIVGDVRSSTDSIGTASQQIATGNQDLSSRTEQTASNLQE
TAASMEQLTSTVRQSADAARQATQMAVANAEVAVRGGQVVGRVVTTMDEINHSSKKIGDI
IGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAAEVRNLAQRSAQAAKEIKGLIETS
VGKVEDGSRLVAQAGSTIGEIVANAEKVSAFISDITTAAGEQSDGIGQVNVAVTQLDQMT
QQNAALVEESAAAAESLKDQAARLAEAVRFFRIDDGAPTLHA