Protein Info for GFF2448 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF13489: Methyltransf_23" amino acids 6 to 164 (159 residues), 43.5 bits, see alignment E=8.4e-15 PF07021: MetW" amino acids 8 to 190 (183 residues), 214.2 bits, see alignment E=4e-67 TIGR02081: methionine biosynthesis protein MetW" amino acids 8 to 192 (185 residues), 235.2 bits, see alignment E=2.4e-74 PF13847: Methyltransf_31" amino acids 17 to 110 (94 residues), 33.3 bits, see alignment E=1.2e-11 PF13649: Methyltransf_25" amino acids 20 to 104 (85 residues), 39.9 bits, see alignment E=1.8e-13 PF08241: Methyltransf_11" amino acids 21 to 107 (87 residues), 47.7 bits, see alignment E=6.1e-16 PF08242: Methyltransf_12" amino acids 21 to 104 (84 residues), 35.1 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: None (inferred from 82% identity to dac:Daci_6043)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>GFF2448 Methionine biosynthesis protein MetW (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSEKPLMDAIARLVPPGSRVLDLGCGDGALLAHLQSSRGCTGYGVEIDDAKVLACMRRGV
NVLQLNLEDGLTMFGDNAFDVVLQIDTLQHLRNAETMLRETARVGRLGVVAFPNFAHWPN
RLHVLQGRMPVTKRLPYQWYDTPNIRVGTHADFEVLARRNGLTIEDSFGLQEGREVRVLP
NLMASTAVFRFSS