Protein Info for GFF2446 in Variovorax sp. SCN45

Annotation: FIG00956403: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 signal peptide" amino acids 20 to 22 (3 residues), see Phobius details amino acids 41 to 43 (3 residues), see Phobius details amino acids 57 to 59 (3 residues), see Phobius details transmembrane" amino acids 23 to 40 (18 residues), see Phobius details amino acids 44 to 56 (13 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 180 to 192 (13 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 424 to 441 (18 residues), see Phobius details amino acids 449 to 466 (18 residues), see Phobius details amino acids 472 to 488 (17 residues), see Phobius details amino acids 494 to 513 (20 residues), see Phobius details amino acids 519 to 541 (23 residues), see Phobius details TIGR01666: TIGR01666 family membrane protein" amino acids 22 to 661 (640 residues), 604.4 bits, see alignment E=2.5e-185 TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 22 to 678 (657 residues), 675.4 bits, see alignment E=8.9e-207 PF12805: FUSC-like" amino acids 73 to 358 (286 residues), 261.9 bits, see alignment E=9.4e-82 PF04632: FUSC" amino acids 402 to 712 (311 residues), 31.2 bits, see alignment E=1.5e-11 PF13515: FUSC_2" amino acids 415 to 533 (119 residues), 82.3 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_4875)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (739 amino acids)

>GFF2446 FIG00956403: hypothetical protein (Variovorax sp. SCN45)
MLPLSPDALRQRLRSFASRAQPVRILLTLGSLMALCGFTGHPDAVIPLFLGAIASALAET
DDSWRGRLRAQVVTLACFAAIAFAVEALFGLPWLFITAFALAAFCLTMLGAVEARYKAIA
YATLILAMYATLGIENMASHGTAALRGREPLLLLAGAAWYGVFSVLWCAIFPAQPVQARL
VTLFTVLGNYVRFKASLFEPLRGIDIERKRLALAQLNAEVVSELNAAKESIFRRIGARAP
TGRISRYRGLYLIAQDVHERASSSHDDYNALADAFFHSDLLYRCQRVLGLQGLACLRLSE
SIARREPFDTGTETVQALADLRSAIEHERARAVTPERLVLLASVEALARNLAQLDGQLAG
ASQPSARAGRTEMGLFDRSPRSWRDAVERVRRQLTVRSPLFRHALRLSIALVAGYGVMQV
IHPAQGYWILLTTLFVCQQTYGDTIARMGQRIAGTALGVVAGWALLQLFPQPLVQSVIAV
AAGVVFFATRATRYLLATASMTLLVLMCFNQVGDSGVLLVPRLVDTAIGSAIAGLAVLLV
LPHWQARRINELAATAMRGHAGYLRQIVEQYRTGARDHLDYRLARRNDHNADAALSTAVS
DMFREPGYVRPRAGVALRFLIRSHTLLSYLSALGAHRAALPDSAQMAVLRGAAEGAVAAL
EALAAGLESGSVDGPRDTAAELAARSALAQATAAGGESDPQARTFHTEMALIWLQIDALR
THASEWLQPEGSETPTAPA