Protein Info for PS417_12465 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF20161: VpsR" amino acids 7 to 115 (109 residues), 27.9 bits, see alignment E=4.3e-10 PF14532: Sigma54_activ_2" amino acids 139 to 305 (167 residues), 67.5 bits, see alignment E=3.9e-22 PF00158: Sigma54_activat" amino acids 139 to 304 (166 residues), 245.2 bits, see alignment E=7.5e-77 PF07728: AAA_5" amino acids 161 to 278 (118 residues), 25.8 bits, see alignment E=2.5e-09 PF25601: AAA_lid_14" amino acids 310 to 381 (72 residues), 70.6 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2695)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UES6 at UniProt or InterPro

Protein Sequence (441 amino acids)

>PS417_12465 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MGGPPVQRRLLVVDPCDDCHGLLPGLRAAGWEVDSCTLEGVGDRSCDVGLLRLQPYHLER
PEAVKELISRSGTEWIAVLSQDVLRLQNVGDFVCEWFFDFHTLPFDVARVQVTLGRAFGM
ARLRGKGYTAVDEPEHELLGDSRPIRELRKLLSKLAPTESPVLIRGDSGTGKELVAKTLH
RQSQRHAKPFVAINCGAIPEHLIQSELFGHEKGAFTGAHQRKIGRIEAANGGTLFLDEIG
DLPMELQANLLRFLQEKQIERVGGSQPIPVDVRVLAATHVDLEAAVEKGTFREDLYYRLN
VLQVVTAPLRERHGDIAMLANHFSRFYSQETGRRPRSFSDDALVAMGEHAWPGNVRELAN
RVRRGLVLAEGRQIEAVDLGLQGQQAISPPMATLEDYKHRAERQALCDVLNRHSDNLSVA
ARVLGVSRPTFYRLLHKHQIR