Protein Info for GFF2444 in Variovorax sp. SCN45

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details PF01027: Bax1-I" amino acids 22 to 223 (202 residues), 152 bits, see alignment E=1e-48

Best Hits

Swiss-Prot: 35% identical to Y1358_VIBCH: Uncharacterized membrane protein VC_1358 (VC_1358) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06890, (no description) (inferred from 87% identity to vpe:Varpa_4877)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>GFF2444 Integral membrane protein, interacts with FtsH (Variovorax sp. SCN45)
MNNSSPVYASLDLPLASPQERNRVLRNTYWLLALSMVPTVLGAWIGVSTGFSRAMSPGIG
LMVFLGGAFGFMYAIEKTKESAAGVPVLLAFTFFMGLMLSRLVGTVLGLQNGASLVMTAF
AGTGAIFLGMATLSSVIKRDLSGMGKWLFIGAILLLVAGIANFFLKSSALMMTLSVLAIG
IFSAFILHDLKRVKDGLETNYISATLGVYLSIYNVFQSLLALLGIAGGRDE